PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_06119.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 333aa    MW: 37578.8 Da    PI: 10.3907
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_06119.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.1e-161057148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
  Rsa1.0_06119.1_g00001.1 10 KGAWTAEEDSLLRQCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                             79********************************************97 PP

2Myb_DNA-binding47.83.3e-1563108148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+ + +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
  Rsa1.0_06119.1_g00001.1  63 RGKLSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                              78999*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.184561IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-21660IPR009057Homeodomain-like
SuperFamilySSF466895.14E-287104IPR009057Homeodomain-like
SMARTSM007171.1E-14959IPR001005SANT/Myb domain
PfamPF002492.1E-151057IPR001005SANT/Myb domain
CDDcd001674.35E-101257No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2261111IPR009057Homeodomain-like
SMARTSM007171.7E-1462110IPR001005SANT/Myb domain
PROSITE profilePS5129420.26762112IPR017930Myb domain
PfamPF002491.1E-1363108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009745Biological Processsucrose mediated signaling
GO:0009753Biological Processresponse to jasmonic acid
GO:0019430Biological Processremoval of superoxide radicals
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEGSPKGLRK GAWTAEEDSL LRQCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS  60
IKRGKLSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPGCNTKI  120
RKRNIPCSST TPAQKNEVFK PRPRSFTVNN GCSHFNGQPK VDVIPLNVGV NNTNNVCENS  180
ITCKKDAEKY ELVNNLMDGE NMWWKSLLEE SQEPDALVPE ATETEKLATS VFDVEQLWTV  240
KIQRVAPGAR SASELETHRS SKRLQSSLAV RYRRCDPSSS RGSLSKSSGV VASAEILAVS  300
PPWKLRNRRQ TRMYLSFARS ALHSTLSYSS CSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2181115107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4034510.0KM403451.1 Brassica rapa cultivar Zi He anthocyanin R2R3-MYB transcription factor (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716215.11e-162PREDICTED: transcription factor MYB114-like
SwissprotQ9FE251e-126MYB75_ARATH; Transcription factor MYB75
TrEMBLA0A078J6561e-170A0A078J656_BRANA; BnaA02g35530D protein
STRINGBra039763.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.11e-127production of anthocyanin pigment 1